.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ibz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative tellurium resistant like protein (TerD) from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 3ibz Target Id APC7348
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS31415,NP_626615.1, 100226 Molecular Weight 20386.49 Da.
    Residues 191 Isoelectric Point 4.56
    Sequence mgvslskggnvsltkeapgltavivglgwdirtttgtdfdldasalllnsggkvasdahfiffnnlksp dgsvehtgdnitgegegddeqikinlatvpadiekivfpvsiydaenrqqsfgqvrnafirvvnqagea eiarydlsedastetamvfgelyrhgaewkfraigqgyasglrgiaqdfgvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.78 Rfree 0.200
    Matthews' coefficent 2.24 Rfactor 0.163
    Waters 126 Solvent Content 45.04

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3ibz
    1. NMR Structure and Calcium-Binding Properties of the Tellurite Resistance Protein TerD from Klebsiella pneumoniae
    YR Pan, YC Lou, AB Seven, J Rizo, C Chen - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch