.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ic5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of N-terminal domain of putative saccharopine dehydrogenase from Ruegeria pomeroyi. To be Published
    Site MCSG
    PDB Id 3ic5 Target Id APC63807.2
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS31494,AAV93559.1, 3.40.50.720, 246200 Molecular Weight 11847.91 Da.
    Residues 115 Isoelectric Point 6.03
    Sequence mrwnicvvgagkigqmiaallktssnysvtvadhdlaalavlnrmgvatkqvdakdeaglakalggfda visaapffltpiiakaakaagahyfdltedvaatnavralaedsqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.08 Rfree 0.251
    Matthews' coefficent 2.34 Rfactor 0.195
    Waters 118 Solvent Content 47.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch