.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ic6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative methylase family protein from Neisseria gonorrhoeae. To be Published
    Site MCSG
    PDB Id 3ic6 Target Id APC63422.1
    Molecular Characteristics
    Source Neisseria gonorrhoeae fa 1090
    Alias Ids TPS31492,AAW89397.1, 3.40.1280.10, 242231 Molecular Weight 23974.07 Da.
    Residues 220 Isoelectric Point 5.07
    Sequence mtalkpalpdylgniriiltrtshpanigsaaramktmglhrltivtpnlmatpmtenppvfnpddvqs falpeesfilasgaadvlhnaeivatldealadttiacaltsrrreitaplqtprdlvpellqaanrge kvalvfgnetfglsieevracnrlmtingnpdyfslnlaqavqvvcyeifsqtdspmthlqqedhaath eqikgmlahmesv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.59 Rfree 0.24433
    Matthews' coefficent 3.02 Rfactor 0.20867
    Waters 53 Solvent Content 59.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ic6
    1. Computational investigation of pathogenic nsSNPs in CEP63 protein
    A Kumar, R Purohit - Gene, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch