The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a GST-like protein from Pseudomonas syringae to 2.4A. To be Published
    Site MCSG
    PDB Id 3ic8 Target Id APC61706
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS31476,AAO54788.1,, 223283 Molecular Weight 33943.02 Da.
    Residues 310 Isoelectric Point 5.99
    Sequence mselilhhyptslfaekarlmlgfkgvnwrsvtipsimpkpdltaltggyrktpvlqigadiycdtalm arrleqekaspafypqgqefavaglaawadsvlflhavslvfqpesmavrfakvppdaakafiadrsml fnggtasrppveqvkhqwptfmsrlesqlshggdflfgapsiadfsvahtlwflkqtpvtapfvddyps vsvwldrvlgfghgslsdlssaaaieiasnatpaplpdetfidpngfkagdkvaiaavdygveavegel mftgreelilrrednragvvhvhfprlgfrvekr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.246
    Matthews' coefficent 2.34 Rfactor 0.192
    Waters 178 Solvent Content 47.36

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch