.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ic9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of dihydrolipoamide dehydrogenase from Colwellia psychrerythraea 34H. To be Published
    Site MCSG
    PDB Id 3ic9 Target Id APC62701
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS31485,AAZ24299.1, 3.30.390.30, 167879 Molecular Weight 53472.97 Da.
    Residues 489 Isoelectric Point 5.57
    Sequence mkvinvdvaiigtgtagmgayraakkhtdkvvlieggaygttcarvgcmpsklliaaadasyhasqtdl fgiqvdrisvngkavmkriqterdrfvgfvvesvesfdeqdkirgfakfldehtlqvddhsqviakriv iatgsrpnypeflaaagsrlltndnlfelndlpksvavfgpgviglelgqalsrlgvivkvfgrsgsva nlqdeemkryaektfneefyfdakarvistiekedaveviyfdksgqkttesfqyvlaatgrkanvdkl glentsieldkknsplfdeltlqtsvdhifvagdanntltllheaaddgkvagtnagaypviaqgqrra plsvvftepqvasvglslrqiedlyadqdaanyvvgqvsfegqgrsrvmgknkgllnvyadrtsgeflg aemfgpaaehighllawarqqqmtvqamltmpfyhpvieeglrtalrdaqqklaiekhdmnefimthdnamklvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.23338
    Matthews' coefficent 3.06 Rfactor 0.18612
    Waters 981 Solvent Content 59.85

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 4
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch