.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ica

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the beta subunit of a phenylalanyl-tRNA synthetase from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 3ica Target Id APC61692.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS31475,AAQ65345.1, 3.30.930.10, 242619 Molecular Weight 23997.14 Da.
    Residues 210 Isoelectric Point 5.91
    Sequence drrykwqtvvseqlvgagfneilnnsltagsyyeglkshpremavelmnplsqelncmrqtllfgglet lshnlrrkhlslylfewgkcyrfhaakrtdetplaayaeddrlgiwicgqrvhnswahpeeptsvfelk avveqvlcrvgietgaytlktadndlyasamevktrsgkllgtfgtvstelikrfeieqpvyfaellwd alm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.44 Rfree 0.25486
    Matthews' coefficent 2.33 Rfactor 0.20248
    Waters 161 Solvent Content 47.18

    Ligand Information
    Ligands GOL (GLYCEROL) x 11;TAM (TRIS(HYDROXYETHYL)AMINOMETHANE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ica
    1. (3-Chloroacetyl)-indole, a Novel Allosteric AKT Inhibitor, Suppresses Colon Cancer Growth In Vitro and In Vivo
    DJ Kim, K Reddy, MO Kim, Y Li, J Nadas, YY Cho - Cancer Prevention , 2011 - AACR
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch