.
The Open Protein Structure Annotation Network
PDB Keyword
.

3icf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Protein serine/threonine phosphatase from Saccharomyces cerevisiae with similarity to human phosphatase PP5. To be Published
    Site MCSG
    PDB Id 3icf Target Id APC7843
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS31424,NP_011639.1, 4932 Molecular Weight 57991.91 Da.
    Residues 513 Isoelectric Point 7.59
    Sequence mstptaadrakalerknegnvfvkekhflkaiekyteaidldstqsiyfsnrafahfkvdnfqsalndc deaikldpknikayhrralscmallefkkarkdlnvllkakpndpaatkalltcdrfireerfrkaigg aeneakislcqtlnlssfdanadlanyegpklefeqlyddknafkgakiknmsqefiskmvndlflkgk ylpkkyvaaiishadtlfrqepsmvelennstpdvkisvcgdthgqfydvlnlfrkfgkvgpkhtylfn gdfvdrgswscevallfyclkilhpnnfflnrgnhesdnmnkiygfedeckykysqrifnmfaqsfesl platlinndylvmhgglpsdpsatlsdfknidrfaqpprdgafmellwadpqeangmgpsqrglghafg pditdrflrnnklrkifrshelrmggvqfeqkgklmtvfsapnycdsqgnlggvihvvpghgilqagrn ddqnliietfeavehpdikpmaysnggfgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.23994
    Matthews' coefficent 2.04 Rfactor 0.18993
    Waters 76 Solvent Content 39.62

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;EDO (1,2-ETHANEDIOL) x 2
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1;FE (FE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch