.
The Open Protein Structure Annotation Network
PDB Keyword
.

3icy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium. To be Published
    Site MCSG
    PDB Id 3icy Target Id APC87567.1
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS31524,AAM73277.1, 3.30.450.20, 194439 Molecular Weight 12968.03 Da.
    Residues 115 Isoelectric Point 6.03
    Sequence eelqalvdnipaaiyhldvsgqatirfrppaflktlvsehagttrlntlsmihhddrhmlsnaysklre akhsltlvyrivtpegklhwiedhmrssfsddglfsgidgilcevt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.68 Rfree 0.2483
    Matthews' coefficent 2.76 Rfactor 0.1674
    Waters 39 Solvent Content 55.36

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch