.
The Open Protein Structure Annotation Network
PDB Keyword
.

3idd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cofactor-Independent Phosphoglycerate Mutase from Thermoplasma acidophilum DSM 1728. To be Published
    Site MCSG
    PDB Id 3idd Target Id APC64091
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS31503,CAC11555.1, 3.40.720.10, 2303 Molecular Weight 43930.42 Da.
    Residues 404 Isoelectric Point 6.07
    Sequence mmksiilivldglgdrpgsdlqnrtplqaafrpnlnwlashgingimhpispgircgsdtshmsllgyd pkvyypgrgpfealglgmdirpgdlafranfatnrdgvivdrragrenkgneeladaisldmgeysfrv ksgvehraalvvsgpdlsdmigdsdphreglppekirptdpsgdrtaevmnayleearrilsdhrvnke rvkngrlpgnellvrsagkvpaipsfteknrmkgacvvgspwlkglcrllrmdvfdvpgatgtvgsnyr gkiekavdltsshdfvlvnikatdvaghdgnyplkrdviedidrameplksigdhavicvtgdhstpcs fkdhsgdpvpivfytdgvmndgvhlfdelssasgslritsynvmdilmqlagrsdkfgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.31106
    Matthews' coefficent 2.13 Rfactor 0.23022
    Waters 84 Solvent Content 42.36

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch