.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ig2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Putative Phenylalanyl-tRNA synthetase (PheRS) beta chain domain from Bacteroides fragilis to 2.1A. To be Published
    Site MCSG
    PDB Id 3ig2 Target Id APC61437.2
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS31472,CAH08290.1, 3.30.930.10, 272559 Molecular Weight 23677.66 Da.
    Residues 210 Isoelectric Point 5.75
    Sequence dksnklqnlvaeqlvgcgfneilnnsltraayydglesypsknlvmllnplsadlncmrqtllfggles iahnanrknadlkffefgncyhfdaekknpekvlapysedyhlglwvtgkmvsnswahadentsvyelk ayvenifkrlgldlhslvvgnlsddiystaltvntkggkrlatfgvvtkkmlkafdvdnevyyadlnwk elm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.09 Rfree 0.236
    Matthews' coefficent 2.26 Rfactor 0.195
    Waters 258 Solvent Content 45.60

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3ig2
    1. A structural approach of R A-protein recognition and kinetics of binding in two examples: tR A aminoacylation by arginyl-tR A synthetase and 7SK stabilization
    E Uchikawa - 2011 - scd-theses.u-strasbg.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch