The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Electron Transfer Flavoprotein alpha-subunit from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3ih5 Target Id APC60145.3
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS31462,AAO76912.1,, 226186 Molecular Weight 23692.97 Da.
    Residues 214 Isoelectric Point 5.57
    Sequence nnlfvyceieegivadvslelltkgrslanelncqleavvagtglkeiekqilpygvdklhvfdaegly pytslphtsilvnlfkeeqpqiclmgatvigrdlgprvssaltsgltadctsleigdhedkkegkvykn llyqirpafggnivativnpehrpqmatvregvmkkeivspayqgevirhdvkkyvadtdyvvkvierh vekaknn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.215
    Matthews' coefficent 3.26 Rfactor 0.179
    Waters 313 Solvent Content 62.27

    Ligand Information
    Ligands MLA (MALONIC) x 3;FMT (FORMIC) x 1
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch