.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ijm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a restriction endonuclease-like fold superfamily protein from Spirosoma linguale. TO BE PUBLISHED
    Site MCSG
    PDB Id 3ijm Target Id APC37362
    Molecular Characteristics
    Source 504472
    Alias Ids TPS31440,LVB1KPTGFPAKBQVTJYUHPIQLYHC, 504472 Molecular Weight 16617.05 Da.
    Residues 148 Isoelectric Point 4.95
    Sequence mnyshpislktlvqeddigvnapiihqsviarltaglyplyqskkipfeplpetmltegysspvpdvll ydhqteeakviievcqnsglkhdtskivkliednaygilegfvfnyktqqwlryrlgdggvatnssfse vlqvdlntfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.199
    Matthews' coefficent 2.19 Rfactor 0.166
    Waters 303 Solvent Content 43.96

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;SO4 (SULFATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch