.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ilk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20. To be Published
    Site MCSG
    PDB Id 3ilk Target Id APC63004
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS31487,AAC22038.1, 3.40.1280.10, 71421 Molecular Weight 27249.95 Da.
    Residues 241 Isoelectric Point 8.25
    Sequence mlenirivlietshsgnigsaaramktmgltqlclvspksvdeqsyalsagaenivknarvvdsfdeav ddcplvigtsarlrhlqntlieprecaekvvaykgkiaivfgrerigltneellkchyhlnipanpdys slnlamavqlvsyelrmaflvqnnkknslslieknypttdqlayffdyteriyqslgfiqnqgvmrklk rlyyrakleknelnilngmlsavekridltkedn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.24596
    Matthews' coefficent 2.53 Rfactor 0.20520
    Waters 119 Solvent Content 51.39

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5;ACT (ACETATE) x 1;SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch