The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of First ORF in transposon ISC1904 from Sulfolobus solfataricus P2. To be Published
    Site MCSG
    PDB Id 3ilx Target Id APC64054.1
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS31501,AAK43047.1,, 273057 Molecular Weight 16134.87 Da.
    Residues 140 Isoelectric Point 6.21
    Sequence kvilyarvssntqkddlanqvkyleeqvkeydlvitdigsglnmkrkgflkllrmilnnevsrvitayp drlvrfgfeileevckahnceivvlnqedktpeeelvedlatilvsfsgklhgmrsqkyekvkkcaeel kn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23628
    Matthews' coefficent 2.38 Rfactor 0.18772
    Waters 200 Solvent Content 48.31

    Ligand Information
    Ligands GOL (GLYCEROL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch