The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of one domain of the PTS system, IIabc component from Clostridium difficile. To be Published
    Site MCSG
    PDB Id 3ipj Target Id APC62631.3
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS31483,CAJ67297.1, 3.30.1360.60, 272563 Molecular Weight 10496.74 Da.
    Residues 92 Isoelectric Point 8.68
    Sequence nkynkianelikiigedniisithcatrlrvmvkdreiindkkvekvdevkgvfftsgqyqiilgtgiv nkvyaevekmglktlskkeqdel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.1699
    Matthews' coefficent 2.19 Rfactor 0.1334
    Waters 257 Solvent Content 43.77

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch