.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the HPT domain of Sensor protein barA from Escherichia coli CFT073. TO BE PUBLISHED
    Site MCSG
    PDB Id 3iqt Target Id APC36431.1
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS31437,AAN81797.1, 199310 Molecular Weight 13461.70 Da.
    Residues 120 Isoelectric Point 4.56
    Sequence vneivvnpnatldwqlalrqaagktdlardmlqmlldflpevrnkveeqlvgenpeglvdlihklhgsc gysgvprmknlcqlieqqlrsgtkeedlepellelldemdnvareaskilg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.181
    Matthews' coefficent 1.86 Rfactor 0.141
    Waters 141 Solvent Content 33.82

    Ligand Information
    Ligands BTB (2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch