The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of one domain of the conserved protein from Methanosarcina mazei Go1. To be Published
    Site MCSG
    PDB Id 3ira Target Id APC61675.3
    Molecular Characteristics
    Source Methanosarcina mazei go1
    Alias Ids TPS31474,AAM30315.1,, 192952 Molecular Weight 20019.91 Da.
    Residues 172 Isoelectric Point 5.19
    Sequence epnrlikekspyllqhaynpvdwypwgeeafekarkenkpvflsigystchwchmmahesfedeevagl mneafvsikvdreerpdidniymtvcqiilgrggwplniimtpgkkpffagtyipkntrfnqigmlelv prikeiweqqheevldsaekitstiqemikessg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.21783
    Matthews' coefficent 2.43 Rfactor 0.18696
    Waters 73 Solvent Content 49.34

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch