.
The Open Protein Structure Annotation Network
PDB Keyword
.

3is6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a domain of a putative Permease protein from Porphyromonas gingivalis to 2A. To be Published
    Site MCSG
    PDB Id 3is6 Target Id APC90182.2
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS31539,AAQ65859.1, 242619 Molecular Weight 27582.91 Da.
    Residues 244 Isoelectric Point 5.35
    Sequence qrsyerdfphhdricivkthgtrqsqegdkpeeldfsqvsggvapaiqeeipgvelatrttlygtskmi lednktyetktllaepafldmfgveliagvrdsalrdnmtcliseslarkmggdvlgkrlrpaesksdr aitiggvfedlphnssiqadmllpitwmpaeslnnwigndryiayvrlrpgvspesldeallemqkrhq dmevfrkagvelhysltpfnrlrledptlvnmlriqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.259
    Matthews' coefficent 2.43 Rfactor 0.213
    Waters 189 Solvent Content 49.40

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3is6
    1. Structural basis for Ca2+-independence and activation by homodimerization of tomato subtilase 3
    C Ottmann, R Rose, F Huttenlocher - Proceedings of the , 2009 - National Acad Sciences
     
    2. A plant alternative to animal caspases: subtilisin-like proteases
    AB Vartapetian, AI Tuzhikov, NV Chichkova - Cell Death & , 2011 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch