.
The Open Protein Structure Annotation Network
PDB Keyword
.

3isr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Putative Cysteine Protease from Cytophaga hutchinsonii to 1.9A. To be Published
    Site MCSG
    PDB Id 3isr Target Id APC62855
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS31486,ABG59854.1, 3.90.260.10, 269798 Molecular Weight 31715.14 Da.
    Residues 282 Isoelectric Point 5.26
    Sequence mkfkihsdityqvmspttfifnvhalrtesqhildeslivtppieieefsynsgtsrfvrlkatenttf smsytatvdtqykvidqrqeletvpvvdldgdiipflfpsrycqsdklqklaykefgkienvyskvlai tdwiynnveyisgstnsqtsafdtiteragvcrdfahlgialcralsiparyftgyafklnppdfhacf eayiggnwiifdatrlvplnglvkiatgrdaadaavasifgnasstnmhvecasldtdftpfwydknsl kglsfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.220
    Matthews' coefficent 2.70 Rfactor 0.187
    Waters 565 Solvent Content 54.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3isr
    1. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     
    2. Cellular and molecular action of the mitogenic protein_deamidating toxin from Pasteurella multocida
    BA Wilson, M Ho - FEBS Journal, 2011 - Wiley Online Library
     
    3. Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila
    D Chatterjee, CD Boyd, GA O'Toole - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch