.
The Open Protein Structure Annotation Network
PDB Keyword
.

3isz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase. J.Mol.Biol. 397 617-626 2010
    Site MCSG
    PDB Id 3isz Target Id APC61309
    Related PDB Ids 3ic1 
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS31471,NP_438276.1, 71421 Molecular Weight 41350.91 Da.
    Residues 377 Isoelectric Point 5.23
    Sequence mkekvvslaqdlirrpsispndegcqqiiaerleklgfqiewmpfndtlnlwakhgtsepviafaghtd vvptgdenqwssppfsaeiidgmlygrgaadmkgslaamivaaeeyvkanpnhkgtiallitsdeeata kdgtihvvetlmardekitycmvgepssaknlgdvvkngrrgsitgnlyiqgiqghvayphlaenpihk aalflqelttyqwdkgneffpptslqianihagtgsnnvipaelyiqfnlryctevtdeiikqkvaeml ekhnlkyriewnlsgkpfltkpgklldsitsaieetigitpkaetgggtsdgrfialmgaevvefgpln stihkvnecvsvedlgkcgeiyhkmlvnllds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.25444
    Matthews' coefficent 2.37 Rfactor 0.20207
    Waters 401 Solvent Content 48.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3isz
    1. Structural basis for catalysis by the mono-and dimetalated forms of the dapE-encoded N-succinyl-L, L-diaminopimelic acid desuccinylase
    BP Nocek, DM Gillner, Y Fan, RC Holz - Journal of molecular , 2010 - Elsevier
     
    2. Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate
    AT Brunger, D Das, AM Deacon, J Grant - Section D: Biological , 2012 - scripts.iucr.org
     
    3. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of succinyl-diaminopimelate desuccinylase (Rv1202, DapE) from
    L Reinhard, J Mueller-Dieckmann - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch