The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative bacterial protein of unknown function (DUF885, PF05960.1, ) from Arthrobacter aurescens TC1, reveals fold similar to that of M32 carboxypeptidases. To be Published
    Site MCSG
    PDB Id 3iuk Target Id APC89533.1
    Molecular Characteristics
    Source Arthrobacter aurescens tc1
    Alias Ids TPS31533,ABM08317.1, PF05960.1, 290340 Molecular Weight 61507.55 Da.
    Residues 559 Isoelectric Point 4.78
    Sequence mttantpvrpksaidavadayteklielnpsfattlglpgheteyqdyspagaaahaeatrlalealag lepsddvdavtldamrerlgleleihqsgwdaadlnniaspaqdiraifdlmptdtvehwehiagraan vpgaiegyiaslraakddrkvaaarqirivieqtgryaaedgffakmaadaslgdaplpaevqdkldag tsaarsaysalgaflrdellpvapekdavgreryslasrsfigaevdleetyawgvqelerliseqekv agqikpgasieeaksilnndparqikgtdalkawmqelsdravseladvhfdipdvmktlecmiaptde ggiyytgpsddfsrpgrmwwsvpagedtfttwsetttvfhegvpghhlqvatatyrrellnnwrrnvcw vsghgegwalyaeqlmlelgylkdpgdhmgmldgqrmraarvvfdigvhlelpvperwgtgtwtpekgf dflkanldisegqlqfeftrylgwpgqapsykvgqrlweqiraelesregfdlksfhskalnigsvgldvlrrall
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.21994
    Matthews' coefficent 2.35 Rfactor 0.16347
    Waters 1525 Solvent Content 47.76

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch