The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the C-terminal domain of the ATP-dependent DNA helicase RecQ from Porphyromonas gingivalis to 1.6A. To be Published
    Site MCSG
    PDB Id 3iuo Target Id APC90268.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS31540,AAQ65617.1, 242619 Molecular Weight 14279.26 Da.
    Residues 122 Isoelectric Point 4.37
    Sequence eneierpedmrvrtlankskmkvsivqqidrkvalddiavshgldfpellsevetivysgtrinidyfi nevmdedhledifeyfkesttdsleeamqelgkdyseeeirlvrikflseman
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.221
    Matthews' coefficent 2.26 Rfactor 0.188
    Waters 182 Solvent Content 48.00

    Ligand Information
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch