.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ius

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a functionally unknown conserved protein from Silicibacter pomeroyi DSS. To be Published
    Site MCSG
    PDB Id 3ius Target Id APC63810
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS31495,AAV96976.1, 3.40.50.720, 246200 Molecular Weight 30743.20 Da.
    Residues 283 Isoelectric Point 5.99
    Sequence mtgtllsfghgytarvlsralapqgwriigtsrnpdqmeairasgaepllwpgeepsldgvthllista pdsggdpvlaalgdqiaaraaqfrwvgylsttavygdhdgawvdettpltptaargrwrvmaeqqwqav pnlplhvfrlagiygpgrgpfsklgkggirriikpgqvfsrihvediaqvlaasmarpdpgavynvcdd epvppqdviayaaelqglplppavdfdkadltpmarsfysenkrvrndrikeelgvrlkypnyrvglea lqadaet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.66 Rfree 0.257
    Matthews' coefficent 2.16 Rfactor 0.217
    Waters 567 Solvent Content 43.11

    Ligand Information
    Ligands FMT (FORMIC) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch