.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative oxidoreductase with a thioredoxin fold. To be Published
    Site MCSG
    PDB Id 3iv4 Target Id APC23140
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS31430,NP_373951, 158879 Molecular Weight 12436.25 Da.
    Residues 106 Isoelectric Point 4.75
    Sequence maiklssidqfeqvieenkyvfvlkhsetcpisanaydqfnkflyerdmdgyylivqqerdlsdyiakk tnvkhespqafyfvngemvwnrdhgdinvsslaqaee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.18988
    Matthews' coefficent Rfactor 0.15250
    Waters 142 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3iv4
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     
    2. Data Fusion for the Problem of Protein Sidechain Assignment
    Y Lei - 2010 - scholarworks.umass.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch