.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ivl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Inactive Peptidase Domain of a Putative Zinc Protease from Bordetella parapertussis to 2.2A. To be Published
    Site MCSG
    PDB Id 3ivl Target Id APC36318.1
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS31436,CAE38767.1, 3.30.830.10, 519 Molecular Weight 22716.48 Da.
    Residues 208 Isoelectric Point 5.76
    Sequence ytvepvqdgersvtlrraggtplvaamyhlpaagspdfvgldlaatiladtpsgrlyhalvptklasgv fgftmdqldpglamfgaqlqpgmdqdkalqtltatleslsskpfsqeelerarskwltawqqtyadpek vgvalseaiasgdwrlfflqrdrvrdaklddvqraavaylvrsnrtegryiptekpqraplaqradlaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.258
    Matthews' coefficent 2.82 Rfactor 0.216
    Waters 51 Solvent Content 56.50

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch