The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Acetyltransferase from GNAT family from Colwellia psychrerythraea. To be Published
    Site MCSG
    PDB Id 3iwg Target Id APC60414
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS5555,AAZ25366.1, 3.40.630.30, 167879 Molecular Weight 30601.39 Da.
    Residues 273 Isoelectric Point 6.44
    Sequence mfkiktieslsdltqlkkayfdssivpldgmwhfgfapmakhfgfyvnknlvgfccvnddgyllqyylq pefqlcsqelftlisqqnssvigevkgafvstaelnyqalcldnsatfkvnslmyqhntkladrnlemi dmqiagteqltafvtfaaanigapeqwltqyygnlierkelfgywhkgkllaagecrlfdqyqteyadl gmivaqsnrgqgiakkvltfltkhaatqgltsicstesnnvaaqkaiahagftsahrivqfefkha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.218
    Matthews' coefficent 2.91 Rfactor 0.181
    Waters 193 Solvent Content 57.66

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch