.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein of DegV family COG1307 with unknown function from Ruminococcus gnavus ATCC 29149. To be Published
    Site MCSG
    PDB Id 3jr7 Target Id APC21410
    Molecular Characteristics
    Source Ruminococcus gnavus atcc 29149
    Alias Ids TPS31429,7QVEFXCPKRQLAW9CLOP6BPFS3H8, 411470 Molecular Weight 33215.25 Da.
    Residues 298 Isoelectric Point 5.57
    Sequence mkttynrwwkkkvwfgrkdmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelll kiaestscaktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsrs asvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgikslvagalnikp imgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnceerakevqrllkerfavkss fivdtsgistvyandggiivvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.20843
    Matthews' coefficent 3.22 Rfactor 0.16198
    Waters 545 Solvent Content 61.82

    Ligand Information
    Ligands PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 2;PO4 (PHOSPHATE) x 2
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch