The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative tagatose 1,6-diphosphate aldolase from Streptococcus pyogenes. To be Published
    Site MCSG
    PDB Id 3jrk Target Id APC80109.1
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS31517,AAK34623.1,, 160490 Molecular Weight 36014.86 Da.
    Residues 322 Isoelectric Point 4.89
    Sequence tenkrksmeklsvdgvisalafdqrgalkrmmaqhqtkeptveqieelkslvseeltpfassilldpey glpasrvrseeaglllayektgydatttsrlpdcldvwsakrikeagaeavkfllyydidgdqdvneqk kayierigsecraedipfyleiltydekiadnaspefakvkahkvneamkvfskerfgvdvlkvevpvn mkfvegfadgevlftkeeaaqafrdqeastdlpyiylsagvsaklfqdtlvfaaesgakfngvlcgrat wagsvkvyieegpqaarewlrtegfknidelnkvldktaspwtekm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.97 Rfree 0.22985
    Matthews' coefficent 2.60 Rfactor 0.18817
    Waters 1362 Solvent Content 52.75

    Ligand Information
    Ligands GOL (GLYCEROL) x 9



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch