.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jrt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of V. paracholerae: Integron cassette protein Vpc_cass2. To be Published
    Site MCSG
    PDB Id 3jrt Target Id APC7807
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS31423,AUS0113_1_172, 491076 Molecular Weight 19679.71 Da.
    Residues 172 Isoelectric Point 7.09
    Sequence vkmsdkwieieeilsgligdltiavtvlkdyegkaflrepqhqtkrqciwrlcvysivincrkyvelnq kygkefqalipghnhirgvynneinkntaikklrnhcvahvsdkskylkpaevqeeiikmfdgnfadef ldwicpdnisttdkseslvgviellrdavsakl*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.234
    Matthews' coefficent 2.21 Rfactor 0.189
    Waters 30 Solvent Content 44.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch