.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jtf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The CBS Domain Pair Structure of a magnesium and cobalt efflux protein from Bordetella parapertussis in complex with AMP. TO BE PUBLISHED
    Site MCSG
    PDB Id 3jtf Target Id APC62386.1
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS31479,CAE36439.1, 3.20.20.70, 519 Molecular Weight 14307.85 Da.
    Residues 126 Isoelectric Point 4.92
    Sequence ertvadimvprsrmdlldisqplpqllatiietahsrfpvyeddrdniigillakdllrymlepaldir slvrpavfipevkrlnvllrefrasrnhlaividehggisglvtmedvleqivgdie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.31 Rfactor 0.175
    Waters 156 Solvent Content 46.86

    Ligand Information
    Ligands AMP (ADENOSINE) x 2;SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3jtf
    1. Membrane topology and intracellular processing of Cyclin M2 (CNNM2)
    JHF de Baaij, M Stuiver, IC Meij, S Lainez - Journal of Biological , 2012 - ASBMB
     
    2. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch