.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ju1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enoyl-CoA Hydratase/Isomerase Family Protein. To be Published
    Site MCSG
    PDB Id 3ju1 Target Id APC40491
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS31456,NP_717292.1, 211586 Molecular Weight 41715.69 Da.
    Residues 383 Isoelectric Point 4.99
    Sequence mtnlvdkaahsfatqnvvfqtlatasgklvgvvtlnvekalnaldldmvramtvqlnlwkkdpliacvv ldgsgekafcaggdvralyhasvaakgqvtevakvffeeeyrldyllhtygkpvlvwgdgivmggglgl magashkvvtetsriampevtiglypdvggsyflnrmpgkmglflgltayhmnaadacyvgladhylnr ddkelmfdamatldwsdspalnhqrldtminelsnqvdipkgdsvlaesqemidrlmagsltdivtrms tlstdeawlskacatmlagspiswhlayiqtqlgtklslaqcfkweltvsvnvcakgdfcegvrallid kdkqpkwqfadvqsvpnsviediltspwgeehplsqls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.231
    Matthews' coefficent 3.12 Rfactor 0.193
    Waters 424 Solvent Content 60.63

    Ligand Information
    Ligands ACY (ACETIC) x 2;FMT (FORMIC) x 5;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch