The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Succinylglutamic Semialdehyde Dehydrogenase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3ju8 Target Id APC37529.1
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS31441,NP_249589.1, 208964 Molecular Weight 51394.67 Da.
    Residues 487 Isoelectric Point 5.86
    Sequence mmsthyiagqwlagqgetlesldpvgqgvvwsgrgadatqvdaavcaareafpawarrpleqrieller faatlksradelarvigeetgkplwesatevtsmvnkvaisvqafrertgeksgpladatavlrhkphg vvavfgpynfpghlpnghivpallagncvvfkpseltpkvaeltlkawiqaglpagvlnlvqggretgv alaahrgldglfftgssrtgnllhsqfggqpqkilalemggnnplvveevadldaavytiiqsafisag qrctcarrllvpqgawgdallarlvavsatlrvgrfdeqpapfmgavislsaaehllkaqehligkgaq pllamtqpidgaalltpgildvsavaerpdeeffgpllqvirysdfaaaireanatqyglaagllsdsr erfeqflvesragivnwnkqltgaassapfggigasgnhrpsayyaadycaypvaslespsvslpatltpgis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.196
    Matthews' coefficent 2.83 Rfactor 0.158
    Waters 929 Solvent Content 56.48

    Ligand Information
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch