.
The Open Protein Structure Annotation Network
PDB Keyword
.

3juw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative GnaT-family acetyltransferase from Bordetella pertussis. To be Published
    Site MCSG
    PDB Id 3juw Target Id APC60242
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS31463,CAE41161.1, 3.40.630.30, 257313 Molecular Weight 19407.90 Da.
    Residues 172 Isoelectric Point 7.90
    Sequence mtnmrqvlktdrlvlepqsmarfdqwfamerqrdeaghrdltedqawlrlcarqgmwdayacgfyylld pvsgemrgeagfqfrrrgfgpgfdnhpeaawavasahqgrglaaeamqallahhdrssgrqrvvaliar snlpslrlaerlgfrgysdvafdgaahlllerag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.11 Rfree 0.245
    Matthews' coefficent 2.07 Rfactor 0.186
    Waters 304 Solvent Content 40.59

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch