.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jyf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from Klebsiella pneumoniae subsp. pneumoniae MGH 78578. To be Published
    Site MCSG
    PDB Id 3jyf Target Id APC63187.2
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS31489,ABR79958.1, 3.60.21.10, 272620 Molecular Weight 36748.88 Da.
    Residues 339 Isoelectric Point 5.79
    Sequence svnaatvdlrimettdlhsnmmdfdyykdaatekfglvrtaslieqaraevknsvlvdngdviqgsplg dymaakglkegdvhpvykamntlnyavgnlgnhefnygldflhkalagakfpyvnaniidaktgkpmft pyliqdtrvvdsdgqihtlrigyigfvppqimtwdkanlngkvtvnditetarkyipemrakgadvvvv vahsglsadpyqamaensvyylsqvpgvdaimfghahavfpgkdfanikgadiakgtlngvpavmpgmw gdhlgvvdlvlnndsgkwqvtqskaearpiydavakkslaaedgklvsvlkadhdatrefvsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.43 Rfree 0.23079
    Matthews' coefficent 3.44 Rfactor 0.17915
    Waters 492 Solvent Content 64.27

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2;GOL (GLYCEROL) x 9;SO4 (SULFATE) x 3;TAM (TRIS(HYDROXYETHYL)AMINOMETHANE) x 1
    Metals MN (MANGANESE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch