The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative MarR Family Transcriptional Regulator from Acinetobacter sp. ADP. To be Published
    Site MCSG
    PDB Id 3k0l Target Id APC89021
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS31531,YP_046392.1, PF01047.13, 62977 Molecular Weight 17883.68 Da.
    Residues 159 Isoelectric Point 9.13
    Sequence mlrsssvdrkreeeprlsymiarvdriiskyltehlsaleislpqftalsvlaakpnlsnaklaersfi kpqsankilqdllangwiekapdpthgrrilvtvtpsgldklnqcnqvvqqleaqmlqgvdinlaflir nnlelmvknlstfssldqske
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.253
    Matthews' coefficent 2.19 Rfactor 0.183
    Waters 67 Solvent Content 43.75

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch