.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the pterin-binding domain MeTr of 5-methyltetrahydrofolate-homocysteine methyltransferase from Bacteroides thetaiotaomicron. TO BE PUBLISHED
    Site MCSG
    PDB Id 3k13 Target Id APC62233.1
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS31478,AAO75287.1, 3.20.20.20, 226186 Molecular Weight 32921.84 Da.
    Residues 297 Isoelectric Point 4.91
    Sequence levkpeinfvnigercnvagsrkflrlvnekkydealsiarqqvedgalvidvnmddglldartemttf lnlimsepeiarvpvmidsskwevieaglkclqgksivnsislkegeevflehariikqygaatvvmaf dekgqadtaarkievcerayrllvdkvgfnphdiifdpnvlavatgieehnnyavdfieatgwirknlp gahvsggvsnlsfsfrgnnyireamhavflyhaiqqgmdmgivnpgtsvlysdipadtlekiedvvlnr rpdaaerlielaealketmgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.188
    Matthews' coefficent 3.46 Rfactor 0.160
    Waters 684 Solvent Content 64.50

    Ligand Information
    Ligands GOL (GLYCEROL) x 10;THH (N-[4-({[(6S)-2-AMINO-4-HYDROXY-5-METHYL-5,6,7,8-) x 3
    Metals NA (SODIUM) x 5;K (POTASSIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch