The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of beta-xylosidase, family 43 glycosyl hydrolase from Clostridium acetobutylicum at 1.55 A resolution. To be Published
    Site MCSG
    PDB Id 3k1u Target Id APC20493
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS5202,AAK79496.1, 272562 Molecular Weight 38000.73 Da.
    Residues 327 Isoelectric Point 5.22
    Sequence menekilnpiiiqradpmiykhndgyyyftasvpeydrievrkaktieglrnaepvdvwrrhesgemsn liwapeihfingawyiyfaaapdknieddtfnhrmfviqnenenpftgnwvekgriktawesfsldati fehneklyyvwaqqdinikghsniyiaemenpwtlktkpvmltkpeleweikgfwvnegpavlkkngki fitysasatdvnycigmltaeensnlldknswtksqtpvfktsmenhqygpghnsftvsedgkhdvivy harnyteikgdplydpnrhtraqiinwredgtpdfgvpevdsleietpvka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.161
    Matthews' coefficent 2.06 Rfactor 0.136
    Waters 359 Solvent Content 40.16

    Ligand Information
    Metals MG (MAGNESIUM) x 3;NA (SODIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch