The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of sigma-54-dependent transcriptional regulator domain from Chlorobium. To be Published
    Site MCSG
    PDB Id 3k2n Target Id APC87569.1
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS31527,AAM71356.1, 3.30.450.40, 194439 Molecular Weight 19475.18 Da.
    Residues 174 Isoelectric Point 5.47
    Sequence alklmqyigdaigtirdpqelfrtvtdklrllfafdsaviitidrerreasvffemlrfelpeqlrhqt rsiagtwleghlddrtvtvasiardipsfgadgapllwtlhelgmrqivlsplrsggrvigflsfvsae eklwsdgdksllsgvsssiaiavsnalayeelrqre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2803
    Matthews' coefficent 2.35 Rfactor 0.1967
    Waters 37 Solvent Content 47.62

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch