.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of altronate hydrolase (fragment 1-84) from Shigella Flexneri. To be Published
    Site MCSG
    PDB Id 3k3s Target Id APC28040.2
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS31431,AAP18416.1, 198215 Molecular Weight 8990.71 Da.
    Residues 84 Isoelectric Point 6.15
    Sequence mqyikihaldnvavaladlaegtevsvdnqtvtlrqdvarghkfaltdiakganvikyglpigyaladi aagehvhahntrtnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.15 Rfree 0.213
    Matthews' coefficent 2.91 Rfactor 0.174
    Waters 613 Solvent Content 57.78

    Ligand Information
    Ligands MLA (MALONIC) x 2;ACT (ACETATE) x 6
    Metals CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch