.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k6h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a nitroreductase family protein from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 3k6h Target Id APC5990
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS31343,NP_532427.1, 176299 Molecular Weight 21728.84 Da.
    Residues 195 Isoelectric Point 5.50
    Sequence mimtsdiklldylrvrrstpalqlsepgpskgeieeilrlavrvpdhgklapwrfvvyrgeervrlsea alrialeknpdldlqqqeaertrftrapvviavistakphfkipeweqvmsagavclnvifaanasgfa anwltewlafdpaflaeigvsaeekvagyihigsttfppverprpeladvvtwvgdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.05 Rfree 0.2468
    Matthews' coefficent 3.47 Rfactor 0.1918
    Waters Solvent Content 64.57

    Ligand Information
    Ligands SO4 (SULFATE) x 7;FMN (FLAVIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch