The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein CinA with unknown function from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 3kbq Target Id APC6453.2
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS31409,CAC11629.1, 3.40.980.10, 2303 Molecular Weight 18258.35 Da.
    Residues 169 Isoelectric Point 5.92
    Sequence knasvitvgneilkgrtvntnaafignfltyhgyqvrrgfvvmddldeigwafrvalevsdlvvssggl gptfddmtvegfakcigqdlridedalamikkkygqadltpqrlkmakippscrpienpvgtapglica vggkkviilpgvpkemeallkamekdiiipd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24130
    Matthews' coefficent 2.15 Rfactor 0.20282
    Waters 60 Solvent Content 42.79

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch