.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kc2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mitochondrial HAD-like phosphatase from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3kc2 Target Id APC7327
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS31413,NP_012996.1, 4932 Molecular Weight 39403.90 Da.
    Residues 352 Isoelectric Point 8.77
    Sequence migkrffqttskkiafafdidgvlfrgkkpiagasdalkllnrnkipyilltngggfserartefissk ldvdvsplqiiqshtpykslvnkysrilavgtpsvrgvaegygfqdvvhqtdivrynrdiapfsglsde qvmeysrdipdlttkkfdavlvfndphdwaadiqiisdainsengmlntlrneksgkpsipiyfsnqdl lwanpyklnrfgqgafrllvrrlylelngeplqdytlgkptkltydfahhvlidwekrlsgkigqsvkq klpllgtkpstspfhavfmvgdnpasdiigaqnygwnsclvktgvynegddlkeckptlivndvfdavt ktlekya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.169
    Matthews' coefficent 2.19 Rfactor 0.144
    Waters 880 Solvent Content 43.86

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch