.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kd8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cofactor-Independent Phosphoglycerate mutase from Thermoplasma Acidophilum DSM 1728. To be Published
    Site MCSG
    PDB Id 3kd8 Target Id APC64091.1
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS31504,CAC11555.1, 3.40.720.10, 2303 Molecular Weight 43021.44 Da.
    Residues 396 Isoelectric Point 5.96
    Sequence mksiilivldglgdrpgsdlqnrtplqaafrpnlnwlashgingimhpispgircgsdtshmsllgydp kvyypgrgpfealglgmdirpgdlafranfatnrdgvivdrragrenkgneeladaisldmgeysfrvk sgvehraalvvsgpdlsdmigdsdphreglppekirptdpsgdrtaevmnayleearrilsdhrvnker vkngrlpgnellvrsagkvpaipsfteknrmkgacvvgspwlkglcrllrmdvfdvpgatgtvgsnyrg kiekavdltsshdfvlvnikatdvaghdgnyplkrdviedidrameplksigdhavicvtgdhstpcsf kdhsgdpvpivfytdgvmndgvhlfdelssasgslritsynvmdilmqlag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.28782
    Matthews' coefficent 2.30 Rfactor 0.20737
    Waters 145 Solvent Content 46.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kd8
    1. Predicting conserved essential genes in bacteria: in silico identification of putative drug targets
    M Duffield, I Cooper, E McAlister, M Bayliss, D Ford - Mol. BioSyst., 2010 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch