.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kdr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a HK97 Family Phage Portal Protein from Corynebacterium diphtheriae to 2.9A. To be Published
    Site MCSG
    PDB Id 3kdr Target Id APC86570.2
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5857,CAE50355.1, BIG_136.7, 1717 Molecular Weight 32860.29 Da.
    Residues 310 Isoelectric Point 4.99
    Sequence ddslgeavttraealtipavlrarnllsttvartplvcdgtlppfvpvaappgaatmqtpfhrmlatad dllfngvacwaldrdesgtcigaihipldtwqieentvrvngkavdpmevcifvgihggllthasetft darnlvraaarvaqnpaalielrqtnnaqlspddvdriingyvaarrgrnsgvgfsssglevhehemak enlliegrnaaavdvaramnvpaafidatvggtslsyqnaasrmielvtfgveplmsaiearlnqpdmh adhlanplkfdpaalldaipttptigaqphgens
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.90 Rfree 0.24503
    Matthews' coefficent 4.16 Rfactor 0.19763
    Waters 1 Solvent Content 70.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;SO4 (SULFATE) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kdr
    1. Genome gating in tailed bacteriophage capsids
    P Tavares, S Zinn-Justin, EV Orlova - Viral Molecular Machines, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch