.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein BP1543 from Bordetella pertussis Tohama I. To be Published
    Site MCSG
    PDB Id 3kk4 Target Id APC89551
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS31538,CAE41832.1, BIG_962, 257313 Molecular Weight 13900.21 Da.
    Residues 122 Isoelectric Point 7.73
    Sequence mceifiranqrsysvqarslrlhgvatsvrleqlfwdvleeiaardgmrvtqlierlydelvqyrgeaa nftsflrvcclryqvlqaegripadatvpirsldaqavlrglpanlydsrplg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.19921
    Matthews' coefficent Rfactor 0.14518
    Waters 440 Solvent Content

    Ligand Information
    Ligands ACT (ACETATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch