.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kkb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a two-component sensor domain from Pseudomonas aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3kkb Target Id APC37838.3
    Related PDB Ids 3l34 3n24 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS31444,NP_254171.1, 208964 Molecular Weight 14174.95 Da.
    Residues 127 Isoelectric Point 4.97
    Sequence qeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvdsaeqaaldgv rdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagiseaetsarhra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.2201
    Matthews' coefficent 2.11 Rfactor 0.1634
    Waters 181 Solvent Content 41.77

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kkb
    1. Sensor domains of two-component regulatory systems
    J Cheung, WA Hendrickson - Current opinion in microbiology, 2010 - Elsevier
     
    2. Structural characterization of the predominant family of histidine kinase sensor domains
    Z Zhang, WA Hendrickson - Journal of molecular biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch