.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kkc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V. To be Published
    Site MCSG
    PDB Id 3kkc Target Id APC20805
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v
    Alias Ids TPS31427,AAM99337.1, 208435 Molecular Weight 21031.11 Da.
    Residues 174 Isoelectric Point 5.65
    Sequence mvkdrqiqktkvaiynafisllqendyskitvqdviglanvgrstfyshyeskevllkelcedlfhhlf kqgrdvtfeeylvhilkhfeqnqdsiatlllsddpyfllrfrselehdvyprlreeyitkvdipedflk qfllssfietlkwwlhqrqkmtvedllkyyltmver
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.2788
    Matthews' coefficent 2.41 Rfactor 0.2080
    Waters 3 Solvent Content 48.99

    Ligand Information
    Ligands IMD (IMIDAZOLE) x 12
    Metals NI (NICKEL) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch