The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative transcriptional regulator (TetR/AcrR family member) from putative transcriptional regulator (TetR/AcrR family). To be Published
    Site MCSG
    PDB Id 3knw Target Id APC88826
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS31528,YP_047309.1, PF00440.13, 62977 Molecular Weight 23798.39 Da.
    Residues 209 Isoelectric Point 8.27
    Sequence mtthqvkkseakrqhildsgfhlvlrkgfvgvglqeilktsgvpkgsfyhyfeskeafgcellkhyisd yqirlnqlwttetsardklmnylqcwvkdpateqswaesclivkmaaevadlsedmrlimndgvkrlia rmadlirigqqegsiqtsvvpdvlaqviyqmylgaallsklykhkaplfqalestkmmldgcnhvqqdknq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.26327
    Matthews' coefficent 2.52 Rfactor 0.20992
    Waters 25 Solvent Content 51.23

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch