.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ktb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Arsenical Resistance Operon Trans-acting Repressor from Bacteroides vulgatus ATCC 8482. To be Published
    Site MCSG
    PDB Id 3ktb Target Id APC38734.1
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS31452,ABR41786.1, PF06953.1.HMM.1, 435590 Molecular Weight 11443.67 Da.
    Residues 103 Isoelectric Point 5.61
    Sequence mkkieifdpamccptglcgtninpelmriavvieslkkqgiivtrhnlrdepqvyvsnktvndflqkhg adalpitlvdgeiavsqtypttkqmsewtgvnld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.219
    Matthews' coefficent 2.94 Rfactor 0.172
    Waters 487 Solvent Content 58.23

    Ligand Information
    Ligands GOL (GLYCEROL) x 3;ACY (ACETIC) x 2
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3ktb
    1. The 1.4 crystal structure of the ArsD arsenic metallochaperone provides insights into its interaction with the ArsA ATPase
    J Ye, AA Ajees, J Yang, BP Rosen - Biochemistry, 2010 - ACS Publications
     
    2. The ArsD As (III) metallochaperone
    A Abdul Ajees, J Yang, BP Rosen - BioMetals, 2011 - Springer
     
    3. Resonance assignments and secondary structure prediction of the As (III) metallochaperone ArsD in solution
    J Ye, Y He, J Skalicky, BP Rosen - Biomolecular NMR , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch