.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kwp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative methyltransferase from Lactobacillus brevis. To be Published
    Site MCSG
    PDB Id 3kwp Target Id APC64793
    Molecular Characteristics
    Source Lactobacillus brevis atcc 367
    Alias Ids TPS31508,ABJ63753.1, 387344 Molecular Weight 32325.05 Da.
    Residues 293 Isoelectric Point 5.88
    Sequence meqqrsfqtetgghlylvptpignlddmtfravktltavdliaaedtrntqkllnhfeittkqisfheh ntqeripqliaklkqgmqiaqvsdagmpsisdpghelvnacidahipvvplpganagltaliasglapq pfyfygfldrkpkdrkaeiaglaqrpetlifyeaphrlkktlqnlaagfgderpavlcreltkryeefl rgslaelanwaatdtvrgefvvlvggnpapttaattavdlsepidvqvdrliaagekpndaikevaklr gakkqeiyrqyhhldee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.29 Rfree 0.28789
    Matthews' coefficent 2.10 Rfactor 0.21643
    Waters 80 Solvent Content 41.30

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch